PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10002097m
Common NameCICLE_v10002089mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 283aa    MW: 31215.7 Da    PI: 7.6931
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10002097mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.58.5e-302275155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQ YRl
  Ciclev10002097m 22 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQ-YRL 75
                     79************************************************9.776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.9371979IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-291976IPR009057Homeodomain-like
SuperFamilySSF466893.58E-132273IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-212274IPR006447Myb domain, plants
PfamPF002492.5E-72472IPR001005SANT/Myb domain
PfamPF143791.7E-19121166IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MERSAYVSYP YENGVMMTRD PKPRLRWTAD LHDRFVDAVT KLGGPDKATP KSVLRLMGLK  60
GLTLYHLKSH LQYRLGQQTR RQHGADQHKE NNGGSSFVNF YNGSLATSMT SSRGDEDQGP  120
ISEALKCQAE VQQRLQEQLE VQERLQMRIE AQGKYLQAIL QKAQKSLSVD SSVTGNVNAE  180
AARDQLTTFN LAISNLMESM NEQDRKGNAT EFNDMIKKGN ANGSSFRVQG DCGEREGNEG  240
DNKHKVDGGS THFDLNTKGS YDFNGIAANG IGLGPSTMLS YN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432630.10.0hypothetical protein CICLE_v10002089mg
RefseqXP_006471439.10.0PREDICTED: myb family transcription factor APL isoform X4
SwissprotQ9SAK53e-50APL_ARATH; Myb family transcription factor APL
TrEMBLA0A067EUJ40.0A0A067EUJ4_CITSI; Uncharacterized protein
TrEMBLV4T3A20.0V4T3A2_9R
STRINGGLYMA01G01300.11e-96(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.13e-70G2-like family protein